PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_28447g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family TALE
Protein Properties Length: 894aa    MW: 98370.3 Da    PI: 6.8974
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_28447g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.14.1e-106396771854
                    HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
       Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                    lFe   n+yps +++  LA+k+gLt +qV++WF N R +
  MA_28447g0010 639 LFEHflNPYPSDADKHMLARKTGLTRNQVSNWFINARVR 677
                    5775569******************************88 PP

2BELL91.77.4e-30502570472
           BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                    +lqk+k  Ll ll+eV+++Y+qy++  ++vissFe +ag+g+a+pY + A+ka+SrhFrcLkdai++q+
  MA_28447g0010 502 ALQKRKKELLWLLDEVQRQYRQYCDHREMVISSFESIAGVGAATPYLAPASKAMSRHFRCLKDAIKDQV 570
                    69****************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.4E-22400568IPR006563POX domain
PfamPF075261.1E-32406566IPR006563POX domain
PROSITE profilePS5007112.892618681IPR001356Homeobox domain
CDDcd000864.01E-13621682No hitNo description
SMARTSM003895.0E-10621685IPR001356Homeobox domain
SuperFamilySSF466891.33E-17623688IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.2E-28624687IPR009057Homeodomain-like
PfamPF059202.1E-18638677IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 894 aa     Download sequence    Send to blast
MEDRRLKSTS PTTFHSLDRP DREEVFEVPA KFSSHLAQSG IVDDMPGMYT DQSQMLFPEM  60
FNFPNGLELL GVPARDDSVS GSKLGATPNW TRVSDGQQSH EWSLNSIAPK YISNEFSGGA  120
QNMAVGGGMQ FNSMGIVKEG NMQTLHNLHA QADTMQLCLM NPGNGEYSGL GLPISTNMGI  180
SNPSNAVQHH HSGMSSQKHY GELAHQFPTF TRSISADGGV EQLPTNTRES PQTPWQSRIN  240
ELLLLPGGNG NLQNNQFATS QLNNTLNWAN GQVGSSAYNS TQWNEEPLEA KVAGAFGSRD  300
DRFAQGLALS LSSNSQIRVQ PLETKRLISA QDMVSRLQAS SDVKSKPVDV KGTNGFGWFS  360
SYNSNRSDGI LLSAKGSAFL TPHAADSVHA NMATSELVAT RYGVLLENPK YMKVTQELFD  420
ELSNLVGLGY TTISSTVSKQ DRHKLQDNSS LGNRNIHDPA SVSAGPKVGF SIPATATLSS  480
STVPTEMHNA KDQRISSGDL LALQKRKKEL LWLLDEVQRQ YRQYCDHREM VISSFESIAG  540
VGAATPYLAP ASKAMSRHFR CLKDAIKDQV KATCELLGEK ESVGGPGTTK GETPRLRFLE  600
QSLRQQRAFQ QVGMIAEQEA WRPQKGLPQH SISVLRAWLF EHFLNPYPSD ADKHMLARKT  660
GLTRNQVSNW FINARVRLWK PMIEDMYQEE LKESEINAGG QSVKQQKTLT VGKNDEKGTN  720
KHGKTPGGPG DHKQYSSDSD SQEFKNDLSQ NGQDSTSAAV SLPLDSSVVQ EENFDGSFRS  780
GVNQIITTRE AESNMSSANP TIARIKRKQE ENQDHEHGNE KTNVPRSEVG LEFSSNYNHL  840
NGSSGILYHQ QDLTSAQFGS GDHVSLTLGL RHGGNRSIPV ADQEKYQKSM YLSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A2e-15627684158Homeobox protein Meis1
4xrs_B2e-15627684158Homeobox protein Meis1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP13316172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.33e-91BEL1-like homeodomain 4